PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g058200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 220aa    MW: 25274.1 Da    PI: 4.9423
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g058200.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.2e-2061114457
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     ++++++eq++ Le  Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  Csa19g058200.1  61 KRKLSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKN 114
                     45899***********************************************95 PP

2HD-ZIP_I/II123.69.7e-4060151293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +kr+ls+eqv++LE sFe ++kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k++E +y++Lk+ay++++ +++rL++ev +L+e+l e
  Csa19g058200.1  60 RKRKLSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAYENVVVDKCRLDSEVLQLKEQLYE 151
                     8***************************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.63E-1854115IPR009057Homeodomain-like
PROSITE profilePS5007117.02255115IPR001356Homeobox domain
SMARTSM003893.0E-2058119IPR001356Homeobox domain
CDDcd000861.53E-1760116No hitNo description
PfamPF000464.8E-1761114IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-2062121IPR009057Homeodomain-like
PRINTSPR000311.4E-58695IPR000047Helix-turn-helix motif
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PRINTSPR000311.4E-595111IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MNNQNVDDHN LLLISQLYPD VYTSLVPQQG EAKPARRRKR KSKSSAGREE GGGGGNGWFR  60
KRKLSDEQVR MLEISFEDDH KLESERKDRL ASELGLDPRQ VAVWFQNRRA RWKNKRVEDE  120
YTKLKNAYEN VVVDKCRLDS EVLQLKEQLY EAEREIQSLA QRVEGTLISN SPISSSVTVE  180
ANQATPFFGD YDICVDGDGD NLLYSPDYFD GLEWMSQFM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0313620.0BT031362.1 Arabidopsis thaliana unknown protein (At2g18550) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010489561.11e-162PREDICTED: homeobox-leucine zipper protein ATHB-21-like isoform X2
SwissprotQ9ZU701e-138ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLR0I4Z61e-142R0I4Z6_9BRAS; Uncharacterized protein
STRINGAT2G18550.11e-135(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22082677
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.11e-123homeobox protein 21